CYTL1 (NM_018659) Human Recombinant Protein
CAT#: TP306778
Recombinant protein of human cytokine-like 1 (CYTL1), 20 µg
View other "CYTL1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206778 protein sequence
Red=Cloning site Green=Tags(s) MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCV LDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 28244648) |
Reference Data | |
RefSeq | NP_061129 |
Locus ID | 54360 |
UniProt ID | Q9NRR1 |
Refseq Size | 1019 |
Cytogenetics | 4p16.2 |
Refseq ORF | 408 |
Synonyms | C4orf4; C17 |
Summary | C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Intracellular CYTL1, a novel tumor suppressor, stabilizes NDUFV1 to inhibit metabolic reprogramming in breast cancer
,null,
Signal Transduction and Targeted Therapy
,PubMed ID 35115484
[CYTL1]
|
Salvianolic acid B regulates gene expression and promotes cell viability in chondrocytes
,Yang, X;Liu, S;Li, S;Wang, P;Zhu, W;Liang, P;Tan, J;Cui, S;,
J. Cell. Mol. Med
,PubMed ID 28244648
[CYTL1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |