Plzf (ZBTB16) (NM_006006) Human Recombinant Protein
CAT#: TP306745
Recombinant protein of human zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1, 20 µg
View other "Plzf" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206745 representing NM_006006
Red=Cloning site Green=Tags(s) MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHY TLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADG GAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIG QSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGP GTPTRSSVITSARELHYGREESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPS SVTSGLHVQPALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDMAV FCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDEST LKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPY QCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 74.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005997 |
Locus ID | 7704 |
UniProt ID | Q05516 |
Refseq Size | 2417 |
Cytogenetics | 11q23.2 |
Refseq ORF | 2019 |
Synonyms | PLZF; ZNF145 |
Summary | This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416930 | ZBTB16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422693 | ZBTB16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416930 | Transient overexpression lysate of zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1 |
CNY 3,080.00 |
|
LY422693 | Transient overexpression lysate of zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 2 |
CNY 4,840.00 |
|
PH306745 | ZBTB16 MS Standard C13 and N15-labeled recombinant protein (NP_005997) |
CNY 19,520.00 |