CD72 (NM_001782) Human Recombinant Protein
CAT#: TP306609
Recombinant protein of human CD72 molecule (CD72), 20 µg
View other "CD72" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206609 protein sequence
Red=Cloning site Green=Tags(s) MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQP TASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLR QQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALE QKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHS YYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYIC EMTAFRFPD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001773 |
Locus ID | 971 |
UniProt ID | P21854 |
Refseq Size | 1548 |
Cytogenetics | 9p13.3 |
Refseq ORF | 1077 |
Synonyms | CD72b; LYB2 |
Summary | Plays a role in B-cell proliferation and differentiation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | B cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400673 | CD72 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400673 | Transient overexpression lysate of CD72 molecule (CD72) |
CN¥ 3,080.00 |
|
PH306609 | CD72 MS Standard C13 and N15-labeled recombinant protein (NP_001773) |
CN¥ 19,520.00 |
|
TP700240 | Purified recombinant protein of human CD72 molecule (CD72), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CN¥ 6,650.00 |
|
TP720875 | Purified recombinant protein of Human CD72 molecule (CD72) |
CN¥ 1,800.00 |