HSD17B3 (NM_000197) Human Recombinant Protein
CAT#: TP306558
Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 3 (HSD17B3), 20 µg
View other "HSD17B3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206558 protein sequence
Red=Cloning site Green=Tags(s) MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAK RGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLP SHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSK ALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSL IPAWAFYSGAFQRLLLTHYVAYLKLNTKVR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000188 |
Locus ID | 3293 |
UniProt ID | P37058 |
Refseq Size | 1134 |
Cytogenetics | 9q22.32 |
Refseq ORF | 930 |
Synonyms | EDH17B3; SDR12C2 |
Summary | This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Androgen and estrogen metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424871 | HSD17B3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424871 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 3 (HSD17B3) |
CNY 3,080.00 |
|
PH306558 | HSD17B3 MS Standard C13 and N15-labeled recombinant protein (NP_000188) |
CNY 19,520.00 |
其它HSD17B3产品