RPL18 (NM_000979) Human Recombinant Protein
CAT#: TP306317
Recombinant protein of human ribosomal protein L18 (RPL18), 20 µg
View other "RPL18" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206317 protein sequence
Red=Cloning site Green=Tags(s) MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLCLSRMIRKM KLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLS GPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000970 |
Locus ID | 6141 |
UniProt ID | Q07020 |
Refseq Size | 893 |
Cytogenetics | 19q13.33 |
Refseq ORF | 564 |
Synonyms | DBA18; L18 |
Summary | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18E family of ribosomal proteins that is a component of the 60S subunit. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Pathways | Ribosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424425 | RPL18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424425 | Transient overexpression lysate of ribosomal protein L18 (RPL18) |
CNY 3,080.00 |
|
PH306317 | RPL18 MS Standard C13 and N15-labeled recombinant protein (NP_000970) |
CNY 19,520.00 |