COX6B2 (NM_144613) Human Recombinant Protein

CAT#: TP306224L

Recombinant protein of human cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2), 1 mg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 36,000.00


货期*
4周

规格
    • 1 mg

Product images

经常一起买 (2)
COX6B2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
    • 100 ul

CNY 1,999.00
CNY 2,700.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC206224 protein sequence
Red=Cloning site Green=Tags(s)

MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS
WVESWNEQIKNGIFAGKI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 10.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_653214
Locus ID 125965
UniProt ID Q6YFQ2
Refseq Size 1679
Cytogenetics 19q13.42
Refseq ORF 264
Synonyms COXVIB2; CT59
Summary Connects the two COX monomers into the physiological dimeric form.[UniProtKB/Swiss-Prot Function]
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...