MCM4 (NM_182746) Human Recombinant Protein
CAT#: TP306122
Recombinant protein of human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, 20 µg
View other "MCM4" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206122 protein sequence
Red=Cloning site Green=Tags(s) MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQSPAAQDVLFS SPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIV ASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNV NCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDID QLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQ MIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRK DFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQT GALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTT IENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMP RLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALK QSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF EEALRALADDDFLTVTGKTVRLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 96.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_877423 |
Locus ID | 4173 |
UniProt ID | P33991, B3KMX0 |
Refseq Size | 4800 |
Cytogenetics | 8q11.21 |
Refseq ORF | 2589 |
Synonyms | CDC21; CDC54; hCdc21; IMD54; NKCD; NKGCD; P1-CDC21 |
Summary | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Cell cycle, DNA replication |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405345 | MCM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416982 | MCM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405345 | Transient overexpression lysate of minichromosome maintenance complex component 4 (MCM4), transcript variant 2 |
CNY 3,080.00 |
|
LY416982 | Transient overexpression lysate of minichromosome maintenance complex component 4 (MCM4), transcript variant 1 |
CNY 3,080.00 |
|
PH306122 | MCM4 MS Standard C13 and N15-labeled recombinant protein (NP_877423) |
CNY 19,520.00 |
|
PH312292 | MCM4 MS Standard C13 and N15-labeled recombinant protein (NP_005905) |
CNY 19,520.00 |
|
TP312292 | Recombinant protein of human minichromosome maintenance complex component 4 (MCM4), transcript variant 1, 20 µg |
CNY 2,900.00 |