STK38L (NM_015000) Human Recombinant Protein
CAT#: TP306074
Recombinant protein of human serine/threonine kinase 38 like (STK38L), 20 µg
View other "STK38L" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206074 protein sequence
Red=Cloning site Green=Tags(s) MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQH ARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERD ILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFI HRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLA YSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPI SEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vitro kinase assay substrate (PMID: 28689759) |
Reference Data | |
RefSeq | NP_055815 |
Locus ID | 23012 |
UniProt ID | Q9Y2H1 |
Refseq Size | 5110 |
Cytogenetics | 12p11.23 |
Refseq ORF | 1392 |
Synonyms | NDR2 |
Summary | Involved in the regulation of structural processes in differentiating and mature neuronal cells.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Protein Kinase |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Amplification of F-Actin Disassembly and Cellular Repulsion by Growth Factor Signaling
,Yoon, J;Kim, SB;Ahmed, G;Shay, JW;Terman, JR;,
Dev. Cell
,PubMed ID 28689759
[STK38L]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414864 | STK38L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414864 | Transient overexpression lysate of serine/threonine kinase 38 like (STK38L) |
CNY 3,080.00 |
|
PH306074 | STK38L MS Standard C13 and N15-labeled recombinant protein (NP_055815) |
CNY 19,520.00 |