United States
Germany
Japan
United Kingdom
China
RO60 (NM_001042370) Human Recombinant Protein
CAT＃: TP306071
Recombinant protein of human TROVE domain family, member 2 (TROVE2), transcript variant 3, 20 µg
View other "RO60" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206071 protein sequence
Red=Cloning site Green=Tags(s) MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRG CEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMK CGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVH ELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTA LLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEIL KALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKM DIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 60 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001035829 |
| Locus ID | 6738 |
| UniProt ID | P10155 |
| Refseq Size | 2091 |
| Cytogenetics | 1q31.2 |
| Refseq ORF | 1617 |
| Synonyms | RORNP; SSA2; TROVE2 |
| Summary | RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. May stabilize some of these RNAs and protect them from degradation (PubMed:18056422). Binds to endogenous Alu retroelements which are induced by type I interferon and stimulate porinflammaotry cytokine secretion. Regulates the expression of Alu retroelements as well as inflammatory genes (PubMed:26382853).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
| Protein Pathways | Systemic lupus erythematosus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417882 | TROVE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC420859 | TROVE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429213 | TROVE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433215 | TROVE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417882 | Transient overexpression lysate of TROVE domain family, member 2 (TROVE2), transcript variant 2 |
CNY 4,840.00 |
|
| LY420859 | Transient overexpression lysate of TROVE domain family, member 2 (TROVE2), transcript variant 3 |
CNY 3,080.00 |
|
| LY433215 | Transient overexpression lysate of TROVE domain family, member 2 (TROVE2), transcript variant 4 |
CNY 3,080.00 |
|
| PH306071 | TROVE2 MS Standard C13 and N15-labeled recombinant protein (NP_001035829) |
CNY 19,520.00 |
