Cysteine Dioxygenase Type 1 (CDO1) (NM_001801) Human Recombinant Protein
CAT#: TP306067L
Recombinant protein of human cysteine dioxygenase, type I (CDO1), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206067 protein sequence
Red=Cloning site Green=Tags(s) MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKF NLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLH RVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001792 |
Locus ID | 1036 |
UniProt ID | Q16878 |
Refseq Size | 1627 |
Cytogenetics | 5q22.3 |
Refseq ORF | 600 |
Synonyms | CDO-I |
Summary | Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways, Taurine and hypotaurine metabolism |
Documents
FAQs |
SDS |
其它Cysteine Dioxygenase Type 1产品