LTC4S (NM_145867) Human Recombinant Protein
CAT#: TP306062
Recombinant protein of human leukotriene C4 synthase (LTC4S), 20 µg
View other "LTC4S" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206062 protein sequence
Red=Cloning site Green=Tags(s) MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVA GIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALL GQLRTLLPWA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme activity (PMID: 27791009) |
Reference Data | |
RefSeq | NP_665874 |
Locus ID | 4056 |
UniProt ID | Q16873 |
Refseq Size | 680 |
Cytogenetics | 5q35.3 |
Refseq ORF | 450 |
Summary | The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Maresin conjugates in tissue regeneration biosynthesis enzymes in human macrophages
,Dalli, J;Vlasakov, I;Riley, IR;Rodriguez, AR;Spur, BW;Petasis, NA;Chiang, N;Serhan, CN;,
Proc. Natl. Acad. Sci. U.S.A.
,PubMed ID 27791009
[LTC4S]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407849 | LTC4S HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY407849 | Transient overexpression lysate of leukotriene C4 synthase (LTC4S) |
CN¥ 3,080.00 |
|
PH306062 | LTC4S MS Standard C13 and N15-labeled recombinant protein (NP_665874) |
CN¥ 19,520.00 |