NME5 (NM_003551) Human Recombinant Protein
CAT#: TP306058
Recombinant protein of human non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) (NME5), 20 µg
View other "NME5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206058 protein sequence
Red=Cloning site Green=Tags(s) MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNL TAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIR FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPIVEE PY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003542 |
Locus ID | 8382 |
UniProt ID | P56597, A0A0S2Z4L9 |
Refseq Size | 1243 |
Cytogenetics | 5q31.2 |
Refseq ORF | 636 |
Synonyms | NM23-H5; NM23H5; RSPH23 |
Summary | Does not seem to have NDK kinase activity. Confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes including Gpx5. May play a role in spermiogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418593 | NME5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418593 | Transient overexpression lysate of non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) (NME5) |
CNY 3,080.00 |
|
PH306058 | NME5 MS Standard C13 and N15-labeled recombinant protein (NP_003542) |
CNY 19,520.00 |