PMP2 (NM_002677) Human Recombinant Protein
CAT#: TP306053
Recombinant protein of human peripheral myelin protein 2 (PMP2), 20 µg
View other "PMP2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206053 protein sequence
Red=Cloning site Green=Tags(s) MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQE FEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002668 |
Locus ID | 5375 |
UniProt ID | P02689 |
Refseq Size | 3579 |
Cytogenetics | 8q21.13 |
Refseq ORF | 396 |
Synonyms | CMT1G; FABP8; M-FABP; MP2; P2 |
Summary | The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400948 | PMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400948 | Transient overexpression lysate of peripheral myelin protein 2 (PMP2) |
CNY 3,080.00 |
|
PH306053 | PMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002668) |
CNY 19,520.00 |
|
TP720618 | Purified recombinant protein of Human peripheral myelin protein 2 (PMP2) |
CNY 3,140.00 |