GRP78 (HSPA5) (NM_005347) Human Recombinant Protein
CAT#: TP305859
Recombinant protein of human heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) (HSPA5), 20 µg
View other "GRP78" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205859 protein sequence
Red=Cloning site Green=Tags(s) MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTP EGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTF APEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYG LDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRK DNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSD LKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPA PRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERID TRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPI ISKLYGSAGPPPTGEEDTAEKDEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 72.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Protein refolding (PMID: 28416388) WB positive control (PMID: 28679661) Ubiquitination substrate (PMID: 29260979) |
Reference Data | |
RefSeq | NP_005338 |
Locus ID | 3309 |
UniProt ID | P11021, V9HWB4 |
Refseq Size | 3973 |
Cytogenetics | 9q33.3 |
Refseq ORF | 1962 |
Synonyms | BIP; GRP78; HEL-S-89n |
Summary | The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. This protein localizes to the lumen of the endoplasmic reticulum (ER) where it operates as a typical HSP70 chaperone involved in the folding and assembly of proteins in the ER and is a master regulator of ER homeostasis. During cellular stress, as during viral infection or tumorogenesis, this protein interacts with the transmembrane stress sensor proteins PERK (protein kinase R-like endoplasmic reticulum kinase), IRE1 (inositol-requiring kinase 1), and ATF6 (activating transcription factor 6) where it acts as a repressor of the unfolded protein response (UPR) and also plays a role in cellular apoptosis and senescence. Elevated expression and atypical translocation of this protein to the cell surface has been reported in viral infections and some types of cancer cells. At the cell surface this protein may facilitate viral attachment and entry to host cells. This gene is a therapeutic target for the treatment of coronavirus diseases and chemoresistant cancers. [provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome |
Protein Pathways | Antigen processing and presentation, Prion diseases |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
HSPA5 negatively regulates lysosomal activity through ubiquitination of MUL1 in head and neck cancer
,Kim, SY;Kim, HJ;Kim, HJ;Kim, DH;Kim, CH;Han, JH;Byeon, HK;Lee, K;,
Autophagy
,PubMed ID 29260979
[HSPA5]
|
Glucose-regulated protein 78 autoantibody associates with blood-brain barrier disruption in neuromyelitis optica
,Shimizu, F;Schaller, KL;Owens, GP;Cotleur, AC;Kellner, D;Takeshita, Y;Obermeier, B;Kryzer, TJ;Sano, Y;Kanda, T;Lennon, VA;Ransohoff, RM;Bennett, JL;,
Sci Transl Med
,PubMed ID 28679661
[HSPA5]
|
Human GRP78 affinity towards its signaling partners Ire1α and PERK is differently modulated by an unfolded protein client
,Stan, RC;Silva, RL;de Camargo, MM;,
Biochem. Biophys. Res. Commun.
,PubMed ID 28416388
[HSPA5]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417364 | HSPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417364 | Transient overexpression lysate of heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) (HSPA5) |
CNY 3,080.00 |
|
PH305859 | HSPA5 MS Standard C13 and N15-labeled recombinant protein (NP_005338) |
CNY 19,520.00 |
|
TP701043 | Purified recombinant protein of Human heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) (HSPA5), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,106.00 |