PPP1R14A (NM_033256) Human Recombinant Protein
CAT#: TP305799
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 14A (PPP1R14A), 20 µg
View other "PPP1R14A" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205799 protein sequence
Red=Cloning site Green=Tags(s) MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEAD MPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQD RARTAHP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_150281 |
Locus ID | 94274 |
UniProt ID | Q96A00 |
Refseq Size | 782 |
Cytogenetics | 19q13.2 |
Refseq ORF | 441 |
Synonyms | CPI-17; CPI17; PPP1INL |
Summary | The protein encoded by this gene belongs to the protein phosphatase 1 (PP1) inhibitor family. This protein is an inhibitor of smooth muscle myosin phosphatase, and has higher inhibitory activity when phosphorylated. Inhibition of myosin phosphatase leads to increased myosin phosphorylation and enhanced smooth muscle contraction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403236 | PPP1R14A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403236 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 14A (PPP1R14A) |
CNY 3,080.00 |
|
PH305799 | PPP1R14A MS Standard C13 and N15-labeled recombinant protein (NP_150281) |
CNY 19,520.00 |
|
TP720140 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 14A (PPP1R14A) |
CNY 3,140.00 |
其它PPP1R14A产品