COMMD1 (NM_152516) Human Recombinant Protein
CAT#: TP305614M
Recombinant protein of human copper metabolism (Murr1) domain containing 1 (COMMD1), 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205614 protein sequence
Red=Cloning site Green=Tags(s) MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689729 |
Locus ID | 150684 |
UniProt ID | Q8N668 |
Refseq Size | 725 |
Cytogenetics | 2p15 |
Refseq ORF | 570 |
Synonyms | C2orf5; MURR1 |
Summary | COMMD1 is a regulator of copper homeostasis, sodium uptake, and NF-kappa-B (see MIM 164011) signaling (de Bie et al., 2005 [PubMed 16267171]).[supplied by OMIM, Sep 2009] |
Documents
FAQs |
SDS |