C10orf63 (ENKUR) (NM_145010) Human Recombinant Protein
CAT#: TP305483
Recombinant protein of human chromosome 10 open reading frame 63 (C10orf63), 20 µg
View other "C10orf63" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205483 protein sequence
Red=Cloning site Green=Tags(s) MDPTCSSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEK TLPPKKNFDRNVPKKPAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSG LVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKE FQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIANNA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659447 |
Locus ID | 219670 |
UniProt ID | Q8TC29 |
Refseq Size | 3399 |
Cytogenetics | 10p12.1 |
Refseq ORF | 768 |
Synonyms | C10orf63; CFAP106 |
Summary | This gene encodes a protein that interacts with calmodulin and several transient receptor potential canonical cation channel proteins. The encoded protein may function as an adaptor to localize signal transduction machinery to calcium channels. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408146 | ENKUR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408146 | Transient overexpression lysate of enkurin, TRPC channel interacting protein (ENKUR) |
CNY 3,080.00 |
|
PH305483 | ENKUR MS Standard C13 and N15-labeled recombinant protein (NP_659447) |
CNY 19,520.00 |
其它C10orf63产品