KHDRBS2 (NM_152688) Human Recombinant Protein
CAT#: TP305428
Recombinant protein of human KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2), 20 µg
View other "KHDRBS2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205428 protein sequence
Red=Cloning site Green=Tags(s) MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQ YPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAP PGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIAPTAPSRGRGGAI PPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEY DDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTSSSLKAPPQRSARGGYREHPYGRY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689901 |
Locus ID | 202559 |
UniProt ID | Q5VWX1 |
Refseq Size | 2336 |
Cytogenetics | 6q11.1 |
Refseq ORF | 1047 |
Synonyms | SLM-1; SLM1 |
Summary | RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Binds both poly(A) and poly(U) homopolymers. Phosphorylation by PTK6 inhibits its RNA-binding ability (By similarity). Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. Can regulate alternative splicing of NRXN1 in the laminin G-like domain 6 containing the evolutionary conserved neurexin alternative spliced segment 4 (AS4) involved in neurexin selective targeting to postsynaptic partners. Regulates cell-type specific alternative splicing of NRXN1 at AS4 and acts synergystically with SAM68 in exon skipping. In contrast acts antagonistically with SAM68 in NRXN3 exon skipping at AS4. Its phosphorylation by FYN inhibits its ability to regulate splice site selection. May function as an adapter protein for Src kinases during mitosis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407364 | KHDRBS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407364 | Transient overexpression lysate of KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2) |
CNY 3,080.00 |
|
PH305428 | KHDRBS2 MS Standard C13 and N15-labeled recombinant protein (NP_689901) |
CNY 19,520.00 |
其它KHDRBS2产品