KHDRBS2 (NM_152688) Human Mass Spec Standard
CAT#: PH305428
KHDRBS2 MS Standard C13 and N15-labeled recombinant protein (NP_689901)
View other "KHDRBS2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | KHDRBS2 MS Standard C13 and N15-labeled recombinant protein (NP_689901) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205428 |
Predicted MW | 38.9 kDa |
Protein Sequence |
>RC205428 protein sequence
Red=Cloning site Green=Tags(s) MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQ YPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAP PGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIAPTAPSRGRGGAI PPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEY DDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTSSSLKAPPQRSARGGYREHPYGRY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_689901 |
RefSeq Size | 2336 |
RefSeq ORF | 1047 |
Synonyms | SLM-1; SLM1 |
Locus ID | 202559 |
Cytogenetics | 6q11.1 |
Summary | RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Binds both poly(A) and poly(U) homopolymers. Phosphorylation by PTK6 inhibits its RNA-binding ability (By similarity). Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. Can regulate alternative splicing of NRXN1 in the laminin G-like domain 6 containing the evolutionary conserved neurexin alternative spliced segment 4 (AS4) involved in neurexin selective targeting to postsynaptic partners. Regulates cell-type specific alternative splicing of NRXN1 at AS4 and acts synergystically with SAM68 in exon skipping. In contrast acts antagonistically with SAM68 in NRXN3 exon skipping at AS4. Its phosphorylation by FYN inhibits its ability to regulate splice site selection. May function as an adapter protein for Src kinases during mitosis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407364 | KHDRBS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407364 | Transient overexpression lysate of KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2) |
CNY 3,080.00 |
|
TP305428 | Recombinant protein of human KH domain containing, RNA binding, signal transduction associated 2 (KHDRBS2), 20 µg |
CNY 2,900.00 |
其它KHDRBS2产品