PPP3R2 (NM_147180) Human Recombinant Protein
CAT#: TP305406
Recombinant protein of human protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform (PPP3R2), 20 µg
View other "PPP3R2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205406 protein sequence
Red=Cloning site Green=Tags(s) MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGD GEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTI IILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_671709 |
Locus ID | 5535 |
UniProt ID | Q96LZ3 |
Refseq Size | 3401 |
Cytogenetics | 9q31.1 |
Refseq ORF | 519 |
Synonyms | PPP3RL |
Summary | Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.[UniProtKB/Swiss-Prot Function] |
Protein Families | Phosphatase |
Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407775 | PPP3R2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407775 | Transient overexpression lysate of protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform (PPP3R2) |
CNY 3,080.00 |
|
PH305406 | PPP3R2 MS Standard C13 and N15-labeled recombinant protein (NP_671709) |
CNY 19,520.00 |