Chromogranin C (SCG2) (NM_003469) Human Recombinant Protein
CAT#: TP305382
Recombinant protein of human secretogranin II (chromogranin C) (SCG2), 20 µg
View other "Chromogranin C" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205382 protein sequence
Red=Cloning site Green=Tags(s) MAEAKTHWLGAALSLIPLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIENLRQQAH KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQAENEPQSAPKENKPYALNSE KNFPMDMSDDYETQQWPERKLKHMQFPPMYEENSRDNPFKRTNEIVEEQYTPQSLATLESVFQELGKLTG PNNQKRERMDEEQKLYTDDEDDIYKANNIAYEDVVGGEDWNPVEEKIESQTQEEVRDSKENIEKNEQIND EMKRSGQLGIQEEGLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQ LIEISRNLQIPPEDLIEMLKTGEKPNGSVEPERELDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKTPG GAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENR QMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEGDLQEEEQIEQAIKEHLNQGSSQETD KLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 70.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 26538656) |
Reference Data | |
RefSeq | NP_003460 |
Locus ID | 7857 |
UniProt ID | P13521 |
Refseq Size | 2586 |
Cytogenetics | 2q36.1 |
Refseq ORF | 1851 |
Synonyms | CHGC; EM66; SgII; SN |
Summary | The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
REST Regulates Non-Cell-Autonomous Neuronal Differentiation and Maturation of Neural Progenitor Cells via Secretogranin II
,Kim, HJ;Denli, AM;Wright, R;Baul, TD;Clemenson, GD;Morcos, AS;Zhao, C;Schafer, ST;Gage, FH;Kagalwala, MN;,
J. Neurosci.
,PubMed ID 26538656
[SCG2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418654 | SCG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418654 | Transient overexpression lysate of secretogranin II (chromogranin C) (SCG2) |
CNY 3,080.00 |
|
PH305382 | SCG2 MS Standard C13 and N15-labeled recombinant protein (NP_003460) |
CNY 19,520.00 |
|
TP721109 | Purified recombinant protein of Human secretogranin II (SCG2) |
CNY 4,360.00 |
其它Chromogranin C产品