FABP6 (NM_001445) Human Recombinant Protein
CAT#: TP305307
Recombinant protein of human fatty acid binding protein 6, ileal (FABP6), transcript variant 2, 20 µg
View other "FABP6" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205307 protein sequence
Red=Cloning site Green=Tags(s) MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKES NIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001436 |
Locus ID | 2172 |
UniProt ID | P51161 |
Refseq Size | 587 |
Cytogenetics | 5q33.3 |
Refseq ORF | 384 |
Synonyms | I-15P; I-BABP; I-BALB; I-BAP; ILBP; ILBP3; ILLBP |
Summary | This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419932 | FABP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419932 | Transient overexpression lysate of fatty acid binding protein 6, ileal (FABP6), transcript variant 2 |
CNY 3,080.00 |
|
PH305307 | FABP6 MS Standard C13 and N15-labeled recombinant protein (NP_001436) |
CNY 19,520.00 |
|
TP720196 | Recombinant protein of human fatty acid binding protein 6, ileal (FABP6), transcript variant 1 |
CNY 3,140.00 |