GNPTG (NM_032520) Human Recombinant Protein
CAT#: TP305280
Recombinant protein of human N-acetylglucosamine-1-phosphate transferase, gamma subunit (GNPTG), 20 µg
View other "GNPTG" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205280 representing NM_032520
Red=Cloning site Green=Tags(s) MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGK CFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVEL ACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLR TLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEH LGHETPRAKSPEQLRGDPGLRGSL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 33.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115909 |
Locus ID | 84572 |
UniProt ID | Q9UJJ9 |
Refseq Size | 1228 |
Cytogenetics | 16p13.3 |
Refseq ORF | 912 |
Synonyms | C16orf27; GNPTAG; LP2537; RJD9 |
Summary | This gene encodes the gamma sunbunit of the N-acetylglucosamine-1-phosphotransferase complex. This hexameric complex, composed of alpha, beta and gamma subunits, catalyzes the first step in synthesis of a mannose 6-phosphate lysosomal recognition marker. This enzyme complex is necessary for targeting of lysosomal hydrolases to the lysosome. Mutations in the gene encoding the gamma subunit have been associated with mucolipidosis IIIC, also known as mucolipidosis III gamma.[provided by RefSeq, Feb 2010] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403165 | GNPTG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403165 | Transient overexpression lysate of N-acetylglucosamine-1-phosphate transferase, gamma subunit (GNPTG) |
CNY 3,080.00 |
|
PH305280 | GNPTG MS Standard C13 and N15-labeled recombinant protein (NP_115909) |
CNY 19,520.00 |