Monocarboxylic acid transporter 1 (SLC16A1) (NM_003051) Human Recombinant Protein
CAT#: TP305213
Recombinant protein of human solute carrier family 16, member 1 (monocarboxylic acid transporter 1) (SLC16A1), 20 µg
View other "Monocarboxylic acid transporter 1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205213 protein sequence
Red=Cloning site Green=Tags(s) MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMY GGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFY KRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKS KASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAP LVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLS TTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTD GGPKEEESPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003042 |
Locus ID | 6566 |
UniProt ID | P53985 |
Refseq Size | 3927 |
Cytogenetics | 1p13.2 |
Refseq ORF | 1500 |
Synonyms | HHF7; MCT; MCT1; MCT1D |
Summary | The protein encoded by this gene is a proton-linked monocarboxylate transporter that catalyzes the movement of many monocarboxylates, such as lactate and pyruvate, across the plasma membrane. Mutations in this gene are associated with erythrocyte lactate transporter defect. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Oct 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401069 | SLC16A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC433182 | SLC16A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401069 | Transient overexpression lysate of solute carrier family 16, member 1 (monocarboxylic acid transporter 1) (SLC16A1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY433182 | Transient overexpression lysate of solute carrier family 16, member 1 (monocarboxylic acid transporter 1) (SLC16A1), transcript variant 2 |
CN¥ 3,080.00 |
|
PH305213 | SLC16A1 MS Standard C13 and N15-labeled recombinant protein (NP_003042) |
CN¥ 19,520.00 |
其它Monocarboxylic acid transporter 1产品