PCNP (NM_020357) Human Recombinant Protein
CAT#: TP305183
Recombinant protein of human PEST proteolytic signal containing nuclear protein (PCNP), 20 µg
View other "PCNP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 6,281.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205183 protein sequence
Red=Cloning site Green=Tags(s) MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISK FGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPQEAKMRMKNIGRDTP TSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065090 |
Locus ID | 57092 |
UniProt ID | Q8WW12 |
Refseq Size | 2250 |
Cytogenetics | 3q12.3 |
Refseq ORF | 534 |
Summary | May be involved in cell cycle regulation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412527 | PCNP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412527 | Transient overexpression lysate of PEST proteolytic signal containing nuclear protein (PCNP) |
CNY 3,080.00 |
|
PH305183 | PCNP MS Standard C13 and N15-labeled recombinant protein (NP_065090) |
CNY 19,520.00 |