GPR85 (NM_018970) Human Recombinant Protein
CAT#: TP305181
Recombinant protein of human G protein-coupled receptor 85 (GPR85), 20 µg
View other "GPR85" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205181 protein sequence
Red=Cloning site Green=Tags(s) MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRS AICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLA VICMVWTLSVAMAFPPVLDVGTYSFIREEDQCAFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVH DRRKMKPVQFVAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKME KRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCF STTLLYCRKSRLPREPYCVI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061843 |
Locus ID | 54329 |
UniProt ID | P60893, A4D0T8, Q8NEN2 |
Refseq Size | 4948 |
Cytogenetics | 7q31.1 |
Refseq ORF | 1110 |
Synonyms | SREB; SREB2 |
Summary | Members of the G protein-coupled receptor (GPCR) family, such as GPR85, have a similar structure characterized by 7 transmembrane domains. Activation of GPCRs by extracellular stimuli, such as neurotransmitters, hormones, or light, induces an intracellular signaling cascade mediated by heterotrimeric GTP-binding proteins, or G proteins (Matsumoto et al., 2000 [PubMed 10833454]).[supplied by OMIM, Aug 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402723 | GPR85 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431877 | GPR85 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431878 | GPR85 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431879 | GPR85 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402723 | Transient overexpression lysate of G protein-coupled receptor 85 (GPR85), transcript variant 2 |
CNY 3,080.00 |
|
LY431877 | Transient overexpression lysate of G protein-coupled receptor 85 (GPR85), transcript variant 1 |
CNY 3,080.00 |
|
LY431878 | Transient overexpression lysate of G protein-coupled receptor 85 (GPR85), transcript variant 3 |
CNY 3,080.00 |
|
LY431879 | Transient overexpression lysate of G protein-coupled receptor 85 (GPR85), transcript variant 4 |
CNY 3,080.00 |
|
PH305181 | GPR85 MS Standard C13 and N15-labeled recombinant protein (NP_061843) |
CNY 19,520.00 |