ERLIN1 (NM_006459) Human Recombinant Protein
CAT#: TP305137
Recombinant protein of human ER lipid raft associated 1 (ERLIN1), 20 µg
View other "ERLIN1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205137 protein sequence
Red=Cloning site Green=Tags(s) MTQARVLVAAVVGLVAVLLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDE VKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIEL FDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEAIRRNFELMEAEKTKLLIAAQKQKVVEKEAETE RKKAVIEAEKIAQVAKIRFQQKVMEKETEKRISEIEDAAFLAREKAKADAEYYAAHKYATSNKHKLTPEY LELKKYQAIASNSKIYFGSNIPNMFVDSSCALKYSDIRTGRESSLPSKEALEPSGENVIQNKESTG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006450 |
Locus ID | 10613 |
UniProt ID | O75477 |
Refseq Size | 3450 |
Cytogenetics | 10q24.31 |
Refseq ORF | 1038 |
Synonyms | C10orf69; Erlin-1; KE04; KEO4; SPFH1; SPG62 |
Summary | The protein encoded by this gene is part of a protein complex that mediates degradation of inositol 1,4,5-trisphosphate receptors in the endoplasmic reticulum. The encoded protein also binds cholesterol and regulates the SREBP signaling pathway, which promotes cellular cholesterol homeostasis. Defects in this gene have been associated with spastic paraplegia 62. [provided by RefSeq, Dec 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416643 | ERLIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420288 | ERLIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416643 | Transient overexpression lysate of ER lipid raft associated 1 (ERLIN1) |
CNY 3,080.00 |
|
LY420288 | Transient overexpression lysate of ER lipid raft associated 1 (ERLIN1) |
CNY 3,080.00 |
|
PH305137 | ERLIN1 MS Standard C13 and N15-labeled recombinant protein (NP_006450) |
CNY 19,520.00 |