RABL3 (NM_173825) Human Recombinant Protein
CAT#: TP305024
Recombinant protein of human RAB, member of RAS oncogene family-like 3 (RABL3), 20 µg
View other "RABL3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205024 protein sequence
Red=Cloning site Green=Tags(s) MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTCYIELWDVGGS VGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQI PLLVIGTKLDQIHETKRHEVLTTTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFL REGNQIPGFPDRKRFGAGTLKSLHYD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_776186 |
Locus ID | 285282 |
UniProt ID | Q5HYI8 |
Refseq Size | 3883 |
Cytogenetics | 3q13.33 |
Refseq ORF | 708 |
Synonyms | PNCA5 |
Summary | Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function (By similarity). Not required for myeloid cell development (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406430 | RABL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406430 | Transient overexpression lysate of RAB, member of RAS oncogene family-like 3 (RABL3) |
CNY 3,080.00 |
|
PH305024 | RABL3 MS Standard C13 and N15-labeled recombinant protein (NP_776186) |
CNY 19,520.00 |