VAMP5 (NM_006634) Human Recombinant Protein
CAT#: TP304973
Recombinant protein of human vesicle-associated membrane protein 5 (myobrevin) (VAMP5), 20 µg
View other "VAMP5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 3,340.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204973 protein sequence
Red=Cloning site Green=Tags(s) MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR ICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006625 |
Locus ID | 10791 |
UniProt ID | O95183, Q6FG93 |
Refseq Size | 694 |
Cytogenetics | 2p11.2 |
Refseq ORF | 348 |
Summary | Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416522 | VAMP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416522 | Transient overexpression lysate of vesicle-associated membrane protein 5 (myobrevin) (VAMP5) |
CNY 3,080.00 |
|
PH304973 | VAMP5 MS Standard C13 and N15-labeled recombinant protein (NP_006625) |
CNY 19,520.00 |