IRAK (IRAK1) (NM_001025243) Human Recombinant Protein
CAT#: TP304869
Recombinant protein of human interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 3, 20 µg
View other "IRAK" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204869 protein sequence
Red=Cloning site Green=Tags(s) MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVL WPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSAS TFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPSPFCWPLCEISRGTH NFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQ NGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDE RLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG QRAVKTHGARTKYLVYERLEKLQAVVAGVPGHLEAASCIPPSPQENSYVSSTGRAHSGAAPWQPLAAPSG ASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRP TAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDE FQS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 67.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001020414 |
Locus ID | 3654 |
UniProt ID | P51617 |
Refseq Size | 3352 |
Cytogenetics | Xq28 |
Refseq ORF | 1899 |
Synonyms | IRAK; pelle |
Summary | This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase, Transcription Factors |
Protein Pathways | Apoptosis, Neurotrophin signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400603 | IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422494 | IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422495 | IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425491 | IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400603 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 1 |
CNY 4,840.00 |
|
LY422494 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 2 |
CNY 4,840.00 |
|
LY422495 | Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 3 |
CNY 3,080.00 |
|
PH304869 | IRAK1 MS Standard C13 and N15-labeled recombinant protein (NP_001020414) |
CNY 19,520.00 |
|
TP761632 | Purified recombinant protein of Human interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |