NMNAT1 (NM_022787) Human Recombinant Protein
CAT#: TP304825
Recombinant protein of human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), 20 µg
View other "NMNAT1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204825 protein sequence
Red=Cloning site Green=Tags(s) MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMA ELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKS LEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNI HVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_073624 |
Locus ID | 64802 |
UniProt ID | Q9HAN9 |
Refseq Size | 3781 |
Cytogenetics | 1p36.22 |
Refseq ORF | 837 |
Synonyms | LCA9; NMNAT; PNAT1; SHILCA |
Summary | This gene encodes an enzyme which catalyzes a key step in the biosynthesis of nicotinamide adenine dinucleotide (NAD). The encoded enzyme is one of several nicotinamide nucleotide adenylyltransferases, and is specifically localized to the cell nucleus. Activity of this protein leads to the activation of a nuclear deacetylase that functions in the protection of damaged neurons. Mutations in this gene have been associated with Leber congenital amaurosis 9. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14, and 15. [provided by RefSeq, Jul 2014] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402948 | NMNAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402948 | Transient overexpression lysate of nicotinamide nucleotide adenylyltransferase 1 (NMNAT1) |
CNY 3,080.00 |
|
PH304825 | NMNAT1 MS Standard C13 and N15-labeled recombinant protein (NP_073624) |
CNY 19,520.00 |