RRAS (NM_006270) Human Recombinant Protein
CAT#: TP304820
Recombinant protein of human related RAS viral (r-ras) oncogene homolog (RRAS), 20 µg
View other "RRAS" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204820 protein sequence
Red=Cloning site Green=Tags(s) MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKIC SVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLV GNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKG GGCPCVLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006261 |
Locus ID | 6237 |
UniProt ID | P10301, A0A024QZF2 |
Refseq Size | 1013 |
Cytogenetics | 19q13.33 |
Refseq ORF | 654 |
Synonyms | R-Ras |
Summary | The protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers. [provided by RefSeq, Jul 2015] |
Protein Families | Druggable Genome |
Protein Pathways | MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416758 | RRAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416758 | Transient overexpression lysate of related RAS viral (r-ras) oncogene homolog (RRAS) |
CNY 3,080.00 |
|
PH304820 | RRAS MS Standard C13 and N15-labeled recombinant protein (NP_006261) |
CNY 19,520.00 |