PRAF1 (POLR1E) (NM_022490) Human Recombinant Protein
CAT#: TP304811
Recombinant protein of human polymerase (RNA) I polypeptide E, 53kDa (POLR1E), 20 µg
View other "PRAF1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204811 protein sequence
Red=Cloning site Green=Tags(s) MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYV GNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIE AFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKP EDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFL DTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDF QIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRKVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071935 |
Locus ID | 64425 |
UniProt ID | Q9GZS1 |
Refseq Size | 1884 |
Cytogenetics | 9p13.2 |
Refseq ORF | 1257 |
Synonyms | A49; PAF53; PRAF1; RPA49 |
Summary | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402928 | POLR1E HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402928 | Transient overexpression lysate of polymerase (RNA) I polypeptide E, 53kDa (POLR1E) |
CNY 3,080.00 |
|
PH304811 | POLR1E MS Standard C13 and N15-labeled recombinant protein (NP_071935) |
CNY 19,520.00 |