RBPJK (RBPJ) (NM_203283) Human Recombinant Protein
CAT#: TP304791
Recombinant protein of human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3, 20 µg
View other "RBPJK" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204791 protein sequence
Red=Cloning site Green=Tags(s) MGGCRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKE QMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGV FLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLL DDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTER MYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGG GDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGII YSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_976028 |
Locus ID | 3516 |
UniProt ID | Q06330 |
Refseq Size | 5762 |
Cytogenetics | 4p15.2 |
Refseq ORF | 1455 |
Synonyms | AOS3; CBF-1; CBF1; csl; IGKJRB; IGKJRB1; KBF2; RBP-J; RBP-JK; RBP-J kappa; RBPJK; RBPSUH; SUH |
Summary | The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by recruiting chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins to Notch signaling pathway genes. Several transcript variants encoding different isoforms have been found for this gene, and several pseudogenes of this gene exist on chromosome 9. [provided by RefSeq, Oct 2013] |
Protein Families | Transcription Factors |
Protein Pathways | Notch signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Autophagy Controls CSL/RBPJκ Stability through a p62/SQSTM1-Dependent Mechanism
,null,
Cell reports
,PubMed ID 30231994
[RBPJ]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401647 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC404367 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404368 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC430905 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401647 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1 |
CN¥ 4,840.00 |
|
LY404367 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3 |
CN¥ 3,080.00 |
|
LY404368 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4 |
CN¥ 3,080.00 |
|
PH304791 | RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976028) |
CN¥ 19,520.00 |
|
PH309094 | RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976029) |
CN¥ 19,520.00 |
|
TP309094 | Recombinant protein of human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
|
TP760429 | Purified recombinant protein of Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |