C4BPA (NM_000715) Human Recombinant Protein
CAT#: TP304738
Recombinant protein of human complement component 4 binding protein, alpha (C4BPA), 20 µg
View other "C4BPA" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204738 protein sequence
Red=Cloning site Green=Tags(s) MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETR FKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSC SEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLL GHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIH CDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQK NLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTP SCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELV NGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLP NPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 61.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000706 |
Locus ID | 722 |
UniProt ID | P04003 |
Refseq Size | 2256 |
Cytogenetics | 1q32.2 |
Refseq ORF | 1791 |
Synonyms | C4BP; PRP |
Summary | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. [provided by RefSeq, Jul 2008] |
Protein Pathways | Complement and coagulation cascades |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Fucosylated C4b‑binding protein α‑chain, a novel serum biomarker that predicts lymph node metastasis in pancreatic ductal adenocarcinoma
,Sogawa, K;Yamanaka, S;Takano, S;Sasaki, K;Miyahara, Y;Furukawa, K;Takayashiki, T;Kuboki, S;Takizawa, H;Nomura, F;Ohtsuka, M;,
Oncology Letters
,PubMed ID 33552248
[C4BPA]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424544 | C4BPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424544 | Transient overexpression lysate of complement component 4 binding protein, alpha (C4BPA) |
CNY 3,080.00 |
|
PH304738 | C4BPA MS Standard C13 and N15-labeled recombinant protein (NP_000706) |
CNY 14,250.00 |