CLIC2 (NM_001289) Human Recombinant Protein
CAT#: TP304727
Recombinant protein of human chloride intracellular channel 2 (CLIC2), 20 µg
View other "CLIC2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204727 protein sequence
Red=Cloning site Green=Tags(s) MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA capture for autoantibodies (PMID: 28862243) |
Reference Data | |
RefSeq | NP_001280 |
Locus ID | 1193 |
UniProt ID | O15247 |
Refseq Size | 2694 |
Cytogenetics | Xq28 |
Refseq ORF | 741 |
Synonyms | CLCNL2; CLIC2b; MRXS32; XAP121 |
Summary | This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017] |
Protein Families | Druggable Genome, Ion Channels: Other |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Association of anti-CLIC2 and anti-HMGB1 autoantibodies with higher disease activity in systemic lupus erythematosus patients
,Syahidatulamali, CS;Wan Syamimee, WG;Azwany, YN;Wong, KK;Che Maraina, CH;,
J Postgrad Med
,PubMed ID 28862243
[CLIC2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420025 | CLIC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420025 | Transient overexpression lysate of chloride intracellular channel 2 (CLIC2) |
CNY 3,080.00 |
|
PH304727 | CLIC2 MS Standard C13 and N15-labeled recombinant protein (NP_001280) |
CNY 19,520.00 |
|
TP720238 | Recombinant protein of human chloride intracellular channel 2 (CLIC2) |
CNY 3,140.00 |