Eotaxin (CCL11) (NM_002986) Human Recombinant Protein

CAT#: TP304726

Purified recombinant protein of Human chemokine (C-C motif) ligand 11 (CCL11), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg



  View other "Eotaxin" proteins (6)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
Purified CCL11 mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
    • 100 ul

CN¥ 1,999.00
CN¥ 2,700.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC204726 protein sequence
Red=Cloning site Green=Tags(s)

MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAK
DICADPKKKWVQDSMKYLDQKSPTPKP

myc-FLAG tag
Tag Myc-DDK
Predicted MW 10.7 kDa
Concentration >0.05 µg/µL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_002977
Locus ID 6356
UniProt ID P51671, Q6I9T4
Refseq Size 925
Cytogenetics 17q12
Refseq ORF 291
Synonyms SCYA11
Summary This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity for eosinophils, but not mononuclear cells or neutrophils. This eosinophil-specific chemokine is thought to be involved in eosinophilic inflammatory diseases such as atopic dermatitis, allergic rhinitis, asthma and parasitic infections. [provided by RefSeq, Sep 2014]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Asthma, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...