Carboxypeptidase B (CPB1) (NM_001871) Human Recombinant Protein
CAT#: TP304463
Recombinant protein of human carboxypeptidase B1 (tissue) (CPB1), 20 µg
View other "Carboxypeptidase B" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204463 protein sequence
Red=Cloning site Green=Tags(s) MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFR VKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYNKWETIEAWTQQVATENPALI SRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLDKL DFYVLPVLNIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESE KETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGP GATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001862 |
Locus ID | 1360 |
UniProt ID | P15086 |
Refseq Size | 1473 |
Cytogenetics | 3q24 |
Refseq ORF | 1251 |
Synonyms | CPB; PASP; PCPB |
Summary | Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419699 | CPB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419699 | Transient overexpression lysate of carboxypeptidase B1 (tissue) (CPB1) |
CN¥ 3,080.00 |
|
PH304463 | CPB1 MS Standard C13 and N15-labeled recombinant protein (NP_001862) |
CN¥ 19,520.00 |
|
TP720382 | Recombinant protein of human carboxypeptidase B1 (tissue) (CPB1) |
CN¥ 1,800.00 |
其它Carboxypeptidase B产品