Cleavage stimulation factor 2 (CSTF2) (NM_001325) Human Recombinant Protein
CAT#: TP304450
Recombinant protein of human cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa (CSTF2), 20 µg
View other "Cleavage stimulation factor 2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204450 protein sequence
Red=Cloning site Green=Tags(s) MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETA LSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQM FELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHG AGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQA QVGMPGSGPVSMERGQVPMQDPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAM EARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINM GAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQR QSILILKEQIQKSTGAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001316 |
Locus ID | 1478 |
UniProt ID | P33240 |
Refseq Size | 2027 |
Cytogenetics | Xq22.1 |
Refseq ORF | 1731 |
Synonyms | CstF-64 |
Summary | This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
RNA Binding Protein CELF2 Regulates Signal-Induced Alternative Polyadenylation by Competing with Enhancers of the Polyadenylation Machinery
,Chatrikhi, R;Mallory, MJ;Gazzara, MR;Agosto, LM;Zhu, WS;Litterman, AJ;Ansel, KM;Lynch, KW;,
Cell Rep
,PubMed ID 31509743
[CSTF2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400533 | CSTF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400533 | Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa (CSTF2) |
CNY 3,080.00 |
|
PH304450 | CSTF2 MS Standard C13 and N15-labeled recombinant protein (NP_001316) |
CNY 19,520.00 |
其它Cleavage stimulation factor 2产品