GJB4 (NM_153212) Human Recombinant Protein
CAT#: TP304406
Recombinant protein of human gap junction protein, beta 4, 30.3kDa (GJB4), 20 µg
View other "GJB4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204406 protein sequence
Red=Cloning site Green=Tags(s) MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFP VSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAA VDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVG KRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_694944 |
Locus ID | 127534 |
UniProt ID | Q9NTQ9 |
Refseq Size | 2840 |
Cytogenetics | 1p34.3 |
Refseq ORF | 798 |
Synonyms | CX30.3; EKV; EKVP2 |
Summary | This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations in this gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. [provided by RefSeq, Dec 2009] |
Protein Families | Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407141 | GJB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407141 | Transient overexpression lysate of gap junction protein, beta 4, 30.3kDa (GJB4) |
CNY 3,080.00 |
|
PH304406 | GJB4 MS Standard C13 and N15-labeled recombinant protein (NP_694944) |
CNY 19,520.00 |