Alkaline Phosphatase (ALPPL2) (NM_031313) Human Recombinant Protein
CAT#: TP304330
Recombinant protein of human alkaline phosphatase, placental-like 2 (ALPPL2), 20 µg
View other "Alkaline Phosphatase" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204330 representing NM_031313
Red=Cloning site Green=Tags(s) MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTA ARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQC NTTRGNEVISVVNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLI SNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPS VTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTET IMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPY TACDLAPPAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112603 |
Locus ID | 251 |
UniProt ID | P10696 |
Refseq Size | 2485 |
Cytogenetics | 2q37.1 |
Refseq ORF | 1596 |
Synonyms | ALPPL; ALPPL2; GCAP |
Summary | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Folate biosynthesis, Metabolic pathways |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
ALPPL2 Is a Potential Diagnostic Biomarker for Pancreatic Cancer-Derived Extracellular Vesicles
,Shin, H;Jung, S;Park, S;Dua, P;Lee, D;,
Molecular Therapy - Methods & Clinical Development
,PubMed ID 31687420
[ALPG]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410562 | ALPPL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410562 | Transient overexpression lysate of alkaline phosphatase, placental-like 2 (ALPPL2) |
CNY 3,080.00 |
|
PH304330 | ALPPL2 MS Standard C13 and N15-labeled recombinant protein (NP_112603) |
CNY 19,520.00 |
其它Alkaline Phosphatase产品