GNLY (NM_006433) Human Recombinant Protein
CAT#: TP304321
Recombinant protein of human granulysin (GNLY), transcript variant NKG5, 20 µg
View other "GNLY" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204321 protein sequence
Red=Cloning site Green=Tags(s) MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCL TIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIP STGPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006424 |
Locus ID | 10578 |
UniProt ID | P22749 |
Refseq Size | 751 |
Cytogenetics | 2p11.2 |
Refseq ORF | 435 |
Synonyms | D2S69E; LAG-2; LAG2; NKG5; TLA519 |
Summary | The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401936 | GNLY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401936 | Transient overexpression lysate of granulysin (GNLY), transcript variant NKG5 |
CNY 3,080.00 |
|
PH304321 | GNLY MS Standard C13 and N15-labeled recombinant protein (NP_006424) |
CNY 19,520.00 |