GNLY (NM_006433) Human Mass Spec Standard
CAT#: PH304321
GNLY MS Standard C13 and N15-labeled recombinant protein (NP_006424)
View other "GNLY" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GNLY MS Standard C13 and N15-labeled recombinant protein (NP_006424) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204321 |
Predicted MW | 16.4 kDa |
Protein Sequence |
>RC204321 protein sequence
Red=Cloning site Green=Tags(s) MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCL TIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIP STGPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006424 |
RefSeq Size | 751 |
RefSeq ORF | 435 |
Synonyms | D2S69E; LAG-2; LAG2; NKG5; TLA519 |
Locus ID | 10578 |
Cytogenetics | 2p11.2 |
Summary | The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401936 | GNLY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401936 | Transient overexpression lysate of granulysin (GNLY), transcript variant NKG5 |
CNY 3,080.00 |
|
TP304321 | Recombinant protein of human granulysin (GNLY), transcript variant NKG5, 20 µg |
CNY 2,900.00 |