DPH3 (NM_206831) Human Recombinant Protein
CAT#: TP304203
Recombinant protein of human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 1, 20 µg
View other "DPH3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204203 protein sequence
Red=Cloning site Green=Tags(s) MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETV PAPSANKELVKC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_996662 |
Locus ID | 285381 |
UniProt ID | Q96FX2 |
Refseq Size | 4065 |
Cytogenetics | 3p25.1 |
Refseq ORF | 246 |
Synonyms | DELGIP; DELGIP1; DESR1; DPH3A; KTI11; ZCSL2 |
Summary | This gene encodes a CSL zinc finger-containing protein that is required for dipthamide biosynthesis. The encoded protein is necessary for the initial step in the modification of a histidine residue in elongation factor-2 to diphthamide. This modified residue is a target for ADP ribosylation by the bacterial toxins diphtheria toxin and Pseudomonas exotoxin A. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404231 | DPH3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404231 | Transient overexpression lysate of DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 1 |
CNY 3,080.00 |
|
PH304203 | DPH3 MS Standard C13 and N15-labeled recombinant protein (NP_996662) |
CNY 19,520.00 |