Bone marrow stromal cell antigen 1 (BST1) (NM_004334) Human Recombinant Protein
CAT#: TP304151
Recombinant protein of human bone marrow stromal cell antigen 1 (BST1), 20 µg
View other "Bone marrow stromal cell antigen 1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204151 protein sequence
Red=Cloning site Green=Tags(s) MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAI WEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADF LSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYE IPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDC ALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004325 |
Locus ID | 683 |
UniProt ID | Q10588 |
Refseq Size | 1497 |
Cytogenetics | 4p15.32 |
Refseq ORF | 954 |
Synonyms | CD157 |
Summary | Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Calcium signaling pathway, Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418052 | BST1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418052 | Transient overexpression lysate of bone marrow stromal cell antigen 1 (BST1) |
CNY 3,080.00 |
|
PH304151 | BST1 MS Standard C13 and N15-labeled recombinant protein (NP_004325) |
CNY 19,520.00 |
其它Bone marrow stromal cell antigen 1产品