EB3 (MAPRE3) (NM_012326) Human Recombinant Protein
CAT#: TP304135
Recombinant protein of human microtubule-associated protein, RP/EB family, member 3 (MAPRE3), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204135 protein sequence
Red=Cloning site Green=Tags(s) MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHE YIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPN PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLV DLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDE Y myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036458 |
Locus ID | 22924 |
UniProt ID | Q9UPY8 |
Refseq Size | 1880 |
Cytogenetics | 2p23.3 |
Refseq ORF | 843 |
Synonyms | EB3; EBF3; EBF3-S; RP3 |
Summary | The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
The NAP motif of activity-dependent neuroprotective protein (ADNP) regulates dendritic spines through microtubule end binding proteins.
,null,
Molecular psychiatry
,PubMed ID 25178163
[MAPRE3]
|
A bright monomeric green fluorescent protein derived from Branchiostoma lanceolatum
,null,
Nature methods
,PubMed ID 23524392
[MAPRE3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415770 | MAPRE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415770 | Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 3 (MAPRE3) |
CNY 3,080.00 |
|
PH304135 | MAPRE3 MS Standard C13 and N15-labeled recombinant protein (NP_036458) |
CNY 19,520.00 |