14-3-3 sigma (SFN) (NM_006142) Human Recombinant Protein
CAT#: TP304045
Recombinant protein of human stratifin (SFN), 20 µg
View other "14-3-3 sigma" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204045 protein sequence
Red=Cloning site Green=Tags(s) MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSN EEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDK KRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSE DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006133 |
Locus ID | 2810 |
UniProt ID | P31947 |
Refseq Size | 1336 |
Cytogenetics | 1p36.11 |
Refseq ORF | 744 |
Synonyms | YWHAS |
Summary | This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cell cycle, p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401850 | SFN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401850 | Transient overexpression lysate of stratifin (SFN) |
CNY 3,080.00 |
|
PH304045 | SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133) |
CNY 19,520.00 |
|
TP720151 | Recombinant protein of human stratifin (SFN) |
CNY 3,140.00 |
其它14-3-3 sigma产品