SAT2 (NM_133491) Human Recombinant Protein
CAT#: TP304044L
Recombinant protein of human spermidine/spermine N1-acetyltransferase family member 2 (SAT2), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204044 protein sequence
Red=Cloning site Green=Tags(s) MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY KALGAQDLTEAEGWHFFCFQGEATRKLAGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_597998 |
Locus ID | 112483 |
UniProt ID | Q96F10 |
Refseq Size | 983 |
Cytogenetics | 17p13.1 |
Refseq ORF | 510 |
Synonyms | SSAT2 |
Summary | Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine > spermidine = spermine >> N(1)acetylspermine = putrescine.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |