BEN Domain Containing Protein 5 (BEND5) (NM_024603) Human Recombinant Protein
CAT#: TP303968
Recombinant protein of human BEN domain containing 5 (BEND5), 20 µg
View other "BEN Domain Containing Protein 5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203968 representing NM_024603
Red=Cloning site Green=Tags(s) MDSLEDAVVPRALYEELLRNYQQQQEEMRHLQQELERTRRQLVQQAKKLKEYGALVSEMKELRDLNRRLQ DVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSGIWVDE EKWHQLQVTQGDSKYTKNLAVMIWGTDVLKNRSVTGVATKKKKDAVPKPPLSPHKLSIVRECLYDRIAQE TVDETEIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078879 |
Locus ID | 79656 |
UniProt ID | Q7L4P6 |
Refseq Size | 1781 |
Cytogenetics | 1p33 |
Refseq ORF | 1263 |
Synonyms | C1orf165 |
Summary | Acts as a transcriptional repressor (PubMed:23468431).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411195 | BEND5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411195 | Transient overexpression lysate of BEN domain containing 5 (BEND5) |
CNY 3,080.00 |
|
PH303968 | BEND5 MS Standard C13 and N15-labeled recombinant protein (NP_078879) |
CNY 19,520.00 |
其它BEN Domain Containing Protein 5产品