ARMC7 (NM_024585) Human Recombinant Protein
CAT#: TP303960
Recombinant protein of human armadillo repeat containing 7 (ARMC7), 20 µg
View other "ARMC7" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203960 protein sequence
Red=Cloning site Green=Tags(s) MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEEN ETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATP VVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078861 |
Locus ID | 79637 |
UniProt ID | Q9H6L4 |
Refseq Size | 2146 |
Cytogenetics | 17q25.1 |
Refseq ORF | 594 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411220 | ARMC7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411220 | Transient overexpression lysate of armadillo repeat containing 7 (ARMC7) |
CNY 3,080.00 |
|
PH303960 | ARMC7 MS Standard C13 and N15-labeled recombinant protein (NP_078861) |
CNY 19,520.00 |